Scaffold Ga0209878_1002804

Overview

Basic Information

• Taxon OID: 3300027163
• Scaffold ID: Ga0209878_1002804
• Source Dataset Name: Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2539
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Columbia River, Washington
• Coordinates
  • Lat. (^o): 46.372
  • Long. (^o): -119.272

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046963	Metagenome	150	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209878_10028042	F046963	N/A	MTVELKDALYSLIDNLMENPQKMRNMASDLKPLAKDDIEVAFGIFVGYVTGGFAELFFESQKRSMTAKEAIEVRKILFERALEMKKAIAYVQAQESRS