NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255102_1062720

Scaffold Ga0255102_1062720


Overview

Basic Information
Taxon OID3300027144 Open in IMG/M
Scaffold IDGa0255102_1062720 Open in IMG/M
Source Dataset NameFreshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012344Metagenome / Metatranscriptome281Y
F040107Metagenome162N

Sequences

Protein IDFamilyRBSSequence
Ga0255102_10627201F040107AGGMTGIEALSLLKDGKLLRRVSWEPHEKCKALDFFGQWIVHLVKEYDNEKLDKELESIFQNSFTFTKTTFDDFFGLFDTIDAGDFLHDDWEIVD
Ga0255102_10627202F012344GGAGVKLSEVLDALMEGKPITRAAWEQKYMYYDKDENVFVYHYSEDEEWELMSWSLDLEPRDVIADDWDIDYWDTEDIKVDEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.