Scaffold Ga0255065_1012591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0255065_1012591

Scaffold Ga0255065_1012591

Overview

Basic Information
Taxon OID	3300027142 Open in IMG/M
Scaffold ID	Ga0255065_1012591 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1735
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location Name	USA: Oregon
Coordinates	Lat. (^o)	46.1812	Long. (^o)	-123.1834	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032950	Metagenome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255065_10125913	F032950	GAG	MNTLVKFVIAAACAVSLMYFDSLDYKPKEKTNVGNSHVGSHNGDYRVRIGNLRLHRVCFVPTKQGARRVVKCPVCDWVRTPDNRYMCKKIERVILATQIKKRKKYGMERIDYQVR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.