NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255080_1026103

Scaffold Ga0255080_1026103


Overview

Basic Information
Taxon OID3300027140 Open in IMG/M
Scaffold IDGa0255080_1026103 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)946
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000441Metagenome / Metatranscriptome1136Y
F001019Metagenome / Metatranscriptome804Y

Sequences

Protein IDFamilyRBSSequence
Ga0255080_10261031F000441AGGAGGMRMSDIYINDQLSKAQALLWSGSLHEVDEAHNIVSNLIRDRL
Ga0255080_10261033F001019AGGMTYEPSLEILEMEYSCSPGGVDTFEVYDKSDIPLSVPIYETESLTDAVLYCYNLGKDFTVKTLAEWNERELSYGN
Ga0255080_10261034F000263N/ALQRLINYDINGLDIMHGELKNLMLIWEKELENAQAIEDESEEAMDSMERKYCEGFLDALTALYKLTYDLSFAIKEKEGQKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.