NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255107_1010347

Scaffold Ga0255107_1010347


Overview

Basic Information
Taxon OID3300027136 Open in IMG/M
Scaffold IDGa0255107_1010347 Open in IMG/M
Source Dataset NameFreshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1812
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000852Metagenome / Metatranscriptome860Y
F013414Metagenome / Metatranscriptome271Y

Sequences

Protein IDFamilyRBSSequence
Ga0255107_10103471F000263N/ANSEDIGLPPHLQRLVNAGVSGLDIMHGELKNLMLIAEQDLASALEQEELSGEAMDSMVRTECEGRLDMLVELYQLTYQLSFAIGARNV
Ga0255107_10103476F000852AGGAMTTKREYLKAQGITVGVRGRFSGAAKVAIQEAISKGVTFSDPQPATKKAK
Ga0255107_10103477F013414AGGCGGMSKTKEIKVAEDLVNLTEDHWFNPAILARYLTDQPFYTVDRIMELVAQIIRWQANRHNDELNTEDGIYNSGQSSEGLFLANELNETLNRLIKTYKWENIKLPVDPAKFIKKMPKVETQSYRHSWLHDTDTRT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.