Scaffold Ga0255070_1000300

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0255070_1000300

Scaffold Ga0255070_1000300

Overview

Basic Information
Taxon OID	3300027133 Open in IMG/M
Scaffold ID	Ga0255070_1000300 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11017
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	21 (91.30%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location Name	USA: Oregon
Coordinates	Lat. (^o)	46.1812	Long. (^o)	-123.1834	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083741	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255070_100030013	F083741	GGAG	MTESEKEYMESLYAGLAMMGYLIRGTPIHRIPEDAKAMAKAMMEDEKVIGLPAIKRRARK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.