| Basic Information | |
|---|---|
| Taxon OID | 3300027098 Open in IMG/M |
| Scaffold ID | Ga0209367_1062455 Open in IMG/M |
| Source Dataset Name | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 919 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Max Planck institute for Marine Microbiology, Germany | |||||||
| Coordinates | Lat. (o) | 51.321602 | Long. (o) | 12.394572 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005109 | Metagenome | 412 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209367_10624551 | F005109 | N/A | MRLWFNFIIIIIDNRGLNARWCLTPFLLSLPTAAYLGQRGSTPAGLPH |
| ⦗Top⦘ |