| Basic Information | |
|---|---|
| Taxon OID | 3300027051 Open in IMG/M |
| Scaffold ID | Ga0209269_1013891 Open in IMG/M |
| Source Dataset Name | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2039 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New Jersey, Arthur Kill intertidal strait | |||||||
| Coordinates | Lat. (o) | 40.58 | Long. (o) | -74.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045834 | Metagenome / Metatranscriptome | 152 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209269_10138913 | F045834 | AGGA | MKRQGEVRMLLFIMTGMAFLFVAAVVPLSGFSIFLAAQVIAIVLGGFTVVSLFRRYRGLDLLSAASIFFLYILMVSLFSPGLVNALAAYLTK |
| ⦗Top⦘ |