Scaffold Ga0209269_1004065

Overview

Basic Information

• Taxon OID: 3300027051
• Scaffold ID: Ga0209269_1004065
• Source Dataset Name: Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5245
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading

Source Dataset Sampling Location

• Location Name: USA: New Jersey, Arthur Kill intertidal strait
• Coordinates
  • Lat. (^o): 40.58
  • Long. (^o): -74.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019675	Metagenome	228	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209269_10040652	F019675	AGG	MLTTKRILALAIGALGVALVVKGAWNGVWPLSYQLFAGVLLLIFAVLRWRSL