| Basic Information | |
|---|---|
| Taxon OID | 3300027028 Open in IMG/M |
| Scaffold ID | Ga0209295_1007771 Open in IMG/M |
| Source Dataset Name | Marine algal microbial communities from Porto, Portugal - Porto_5 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3532 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Portugal: Porto | |||||||
| Coordinates | Lat. (o) | 41.162 | Long. (o) | -8.622 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068389 | Metagenome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209295_10077714 | F068389 | N/A | VTSRDWVYLRNHTRKHKLYPKVTRPYEVLETDGRTHLIDQDGLPYRVSGDHVVPAGPMDPANRPKQPQVAKPDALQPGGSEFVFERFVDDTWDEEGVLWLLVCWFGSGPEDDTWQYSRRQPVAAVYQYYRRKGLLPQDPDKAEPGRDQGLWNQAFFVAVGYIPHPLTCILD |
| ⦗Top⦘ |