Scaffold Ga0208475_1009591

Overview

Basic Information

• Taxon OID: 3300027018
• Scaffold ID: Ga0208475_1009591
• Source Dataset Name: Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 949
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location

• Location Name: Manhattan, Kansas, USA
• Coordinates
  • Lat. (^o): 39.070856
  • Long. (^o): -96.582821

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058769	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208475_10095913	F058769	N/A	TANEIKICVVPDSEQHCKARITYRRSALTPDGNAEVAKLDAHWAEEQRIHWQTAINAALAKGGLHD