NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208475_1006675

Scaffold Ga0208475_1006675


Overview

Basic Information
Taxon OID3300027018 Open in IMG/M
Scaffold IDGa0208475_1006675 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1133
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameManhattan, Kansas, USA
CoordinatesLat. (o)39.070856Long. (o)-96.582821Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003610Metagenome / Metatranscriptome477Y

Sequences

Protein IDFamilyRBSSequence
Ga0208475_10066752F003610AGGAMKQIFLYTSLAVMALAVTTTGAAPERCDGTVQLTSQSNFQVRQAGRQTFVEFDFTGLHDICLADHSVVTGIVEGHLVQRISANGDFSLTFDEVLSYNGGTLGYRGEGSLTRGNWQSNVMTVGLGTGPLAGIHGQGTFVFTGPASLTDVIYYVYTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.