NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207949_1000622

Scaffold Ga0207949_1000622


Overview

Basic Information
Taxon OID3300026999 Open in IMG/M
Scaffold IDGa0207949_1000622 Open in IMG/M
Source Dataset NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2567
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location NameHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.550409Long. (o)-72.180244Alt. (m)Depth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000083Metagenome / Metatranscriptome2471Y
F012806Metagenome / Metatranscriptome277Y
F032790Metagenome / Metatranscriptome179N

Sequences

Protein IDFamilyRBSSequence
Ga0207949_10006222F012806AGGGGGVTDAPPIIIDEDAAIDSAFFGSHAGRSCYARAHRSGWVLVVRQVVAQREPPVMLRVWGRVERVPDDDASCLALWEGCAYPR
Ga0207949_10006224F000083AGGMSTFDEITKEKQRLGEALARVDAQREKLTSQLNELEATERVLARYSTGTQARKMSSAKMSTTGVKAAAPARLRGRRHSATAKSAIGSRRSPNLNDQVLALATGKTQQEITAACKGARPNHVGAAIARHKRAGRVEERDGKLYATQPSGTEQRVAV
Ga0207949_10006225F032790GGAMSVDRETQMTITRREILHRVPQRLKLTEQQSWQDIAQSKGMTYLQRLPEAIPEGQFLVHNSVRPTHPLGSHGFRAWLQAQDEHLEPCDCGWTPELGTHYRVKLKILERDRAARATDFA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.