| Basic Information | |
|---|---|
| Taxon OID | 3300026920 Open in IMG/M |
| Scaffold ID | Ga0208575_1016771 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 668 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Willamette National Forest, Oregon, USA | |||||||
| Coordinates | Lat. (o) | 44.20517707 | Long. (o) | -122.1284473 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021007 | Metagenome / Metatranscriptome | 221 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208575_10167712 | F021007 | GAG | MKQNRHDDMPVVPYGSMSLEEIQEGVSAEAVSYAAGLLVEAIRHYESSTFSARQHKLTLTEAQMIAANLIAKASAHLDDETMEEQLARVRQAIREVKP |
| ⦗Top⦘ |