Scaffold Ga0209892_1015844

Overview

Basic Information

• Taxon OID: 3300026919
• Scaffold ID: Ga0209892_1015844
• Source Dataset Name: Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_23-Sept-14 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 519
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Unclassified → Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Columbia River, Washington
• Coordinates
  • Lat. (^o): 46.372
  • Long. (^o): -119.272

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043284	Metagenome	156	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209892_10158441	F043284	N/A	KLNNTRDKALELIGKTIGLASDAGAIIQQARADGQDIVAICEEAGITEEVGKRYEKVAAAQHKLANGDADPGLMRQTYLRIGFLPDPITMSEPSEPKHFLFPIMQARQWLASRGVKFISQDKGLRAQFLAEAEPIVKTYNELKDSA