Scaffold Ga0208313_103046

Overview

Basic Information

• Taxon OID: 3300026882
• Scaffold ID: Ga0208313_103046
• Source Dataset Name: Extremophilic microbial mat communities from Yellowstone National Park, USA - OSPB_Slides-mat_host_7_15 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2751
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, USA
• Coordinates
  • Lat. (^o): 44.733
  • Long. (^o): -110.709

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051270	Metagenome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208313_1030461	F051270	GAG	VIDMRVGIYGYLRIKELGKVIKNDINYQQLMSVLFQLLNNTIGSNTGANQIVIQGNSSNASVSIGTSTITFSASITVPNLNGFNAILYGYFNLGSNKYMIQLATINTTEQIPAGTYTFEWVINFTDSSGIIFNLMALSLTGNLKSVSVSFSPSPSTVTSALTGNN