Basic Information | |
---|---|
Taxon OID | 3300026871 Open in IMG/M |
Scaffold ID | Ga0207825_102789 Open in IMG/M |
Source Dataset Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 78 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1533 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015418 | Metagenome / Metatranscriptome | 255 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207825_1027892 | F015418 | N/A | VSIRQRLFKGGFQGAMSIVSRRTFTGGLLASALVPSNSAIGQPNDPGSVAIIDTPNNAAKVASKLSAQNVKVVVRFFARKTQLGLREKIMASDGN |
⦗Top⦘ |