NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207823_103898

Scaffold Ga0207823_103898


Overview

Basic Information
Taxon OID3300026860 Open in IMG/M
Scaffold IDGa0207823_103898 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1232
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NameLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044710Metagenome / Metatranscriptome154N

Sequences

Protein IDFamilyRBSSequence
Ga0207823_1038982F044710GGAGMIGSLRVGRRGATSKIGFDHVGEDGARFGDVESSDGRVHLVETLAAAQKFGIDRAYLVEHLAQFAEVGEELADFGVGCIRHVASLGRAPGPADGEISFRPVSR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.