| Basic Information | |
|---|---|
| Taxon OID | 3300026823 Open in IMG/M |
| Scaffold ID | Ga0207759_104474 Open in IMG/M |
| Source Dataset Name | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1186 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Luquillo Experimental Forest Soil, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.0 | Long. (o) | -65.0 | Alt. (m) | Depth (m) | .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002289 | Metagenome / Metatranscriptome | 574 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207759_1044742 | F002289 | N/A | DCPERITAMFGRMMVEPVVHVYPGVDLQTAVTALIKVAENVEIVRWIELPASVLLFLLVPGDPDSGAVYVLDRKKGTWYAVDFEDEQFGGYSVSQLEMLLKECNFLDLIERPGLWRAGLQWVVLPGMRPETAV |
| ⦗Top⦘ |