Scaffold Ga0208710_100347

Overview

Basic Information

• Taxon OID: 3300026790
• Scaffold ID: Ga0208710_100347
• Source Dataset Name: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN607 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2203
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location

• Location Name: Gorham, Kansas, USA
• Coordinates
  • Lat. (^o): 39.05
  • Long. (^o): -99.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048659	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208710_1003472	F048659	GAGG	MPMCADCQAARGHGGGPYPVMTRAEMRAGLDLLPTWALEQKAAANRQVIAVMRERLAAGQAVARMYQEPGLAWLERQAQAGEALIIQRQTQGHQADP