| Basic Information | |
|---|---|
| Taxon OID | 3300026686 Open in IMG/M |
| Scaffold ID | Ga0208213_100790 Open in IMG/M |
| Source Dataset Name | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1097 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1096 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Nunn, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 40.81667 | Long. (o) | -104.76667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092685 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208213_1007902 | F092685 | GGAG | VPAHVLVLDAAEGIGPWARDALAHAGLACALVKEDVEARRSVDAQWPALVVVPLDEVRRWSPVLERLAEGPTAIPTSAP |
| ⦗Top⦘ |