Basic Information | |
---|---|
Taxon OID | 3300026560 Open in IMG/M |
Scaffold ID | Ga0208282_10397 Open in IMG/M |
Source Dataset Name | Saline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 1 Metagenome VIRRA1 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3878 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Natrialbales → Natrialbaceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Rauer Lake | |||||||
Coordinates | Lat. (o) | -68.8136 | Long. (o) | 77.9341 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044223 | Metagenome | 155 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208282_103977 | F044223 | N/A | MSNKTTIGLKVSHERNARIERKVDDAGYGSRQAYIRQLIDDDLGGFDTTVESVTTQHTPDDRRDAEIYDALLDLIPLKGWTRFGRFKGDIAQSTGYPKEALFGELKSLRRNGFCTIRVLNPTDESPHYEIKVKPPAADPEQWTHHETDDRPDLFGHGVPDDNETNAAKHHLLFAIEDGDEELIDGFDLQEFGLR |
⦗Top⦘ |