| Basic Information | |
|---|---|
| Taxon OID | 3300026549 Open in IMG/M |
| Scaffold ID | Ga0256404_1020495 Open in IMG/M |
| Source Dataset Name | Bovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_01 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7053 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium RM5 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Alberta | |||||||
| Coordinates | Lat. (o) | 49.6935 | Long. (o) | -112.8418 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013656 | Metagenome | 269 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256404_10204954 | F013656 | GAGG | MKNKIYKIPLKSEEETTINVLYNENILSIYTNKVGLQKQLNKLIGEPTKEDMIKRSIAGSRWDIPLSDKVRISRLVLKANLFEL |
| ⦗Top⦘ |