Basic Information | |
---|---|
Taxon OID | 3300026539 Open in IMG/M |
Scaffold ID | Ga0256872_10340944 Open in IMG/M |
Source Dataset Name | Metatranscriptome of bovine rumen microbial communities from Lethbridge, Alberta, Canada - Rumen RJG_08 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 682 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Alberta | |||||||
Coordinates | Lat. (o) | 49.6935 | Long. (o) | -112.8418 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004268 | Metagenome / Metatranscriptome | 446 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256872_103409441 | F004268 | N/A | CCVSNSTLLGEQFIRDILADESLKLRNFSYMELLNEIVSKRVEQEIPKDHVKQFLLPEFYDGDKSDLNEVYINSIFDFILNHLEEKNNMYLVLLYFYPFIKHSQDEKKHENFFNTIRFITQSHKLEISRANVRQWLFQYISFCSWGITYAIRIKMPPSDDLNNSIKMLLKGPYSEDQLNSFLDKLMSSLNDGIPTRTINLKMFKKMFEKYDISNIENVRDFLLEEK |
⦗Top⦘ |