Scaffold Ga0209157_1131129

Overview

Basic Information

• Taxon OID: 3300026537
• Scaffold ID: Ga0209157_1131129
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1148
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California: Angelo Coastal Reserve
• Coordinates
  • Lat. (^o): 39.7392
  • Long. (^o): -123.6308
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085436	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209157_11311291	F085436	AGGCGG	MRTLLVTLSGTHGTGKSTNAGRIYYLLNGSGRKFSYLRHQDLLDPFGFIVRRAARILHVDVNYLERSTPVRILWSLYFLVIYCPILVGGIGLRRRFGYSVVTDRYIYDLIVGF