Scaffold Ga0256841_1007272

Overview

Basic Information

• Taxon OID: 3300026534
• Scaffold ID: Ga0256841_1007272
• Source Dataset Name: Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 356-308
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7304
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: Mid Atlantic Ridge
• Coordinates
  • Lat. (^o): 37.2904
  • Long. (^o): -32.2765
  • Depth (m): 1672

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099975	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256841_10072722	F099975	GAG	LRKVKEIKGLRGDVLEYVAQGIPQIDAEIAEKGHLWMETS