NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256870_1005359

Scaffold Ga0256870_1005359


Overview

Basic Information
Taxon OID3300026525 Open in IMG/M
Scaffold IDGa0256870_1005359 Open in IMG/M
Source Dataset NameMetatranscriptome of bovine rumen microbial communities from Lethbridge, Alberta, Canada - Rumen RJG_06 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5510
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameCanada: Alberta
CoordinatesLat. (o)49.6935Long. (o)-112.8418Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041054Metagenome / Metatranscriptome160Y
F052997Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0256870_10053595F052997AGGAGGMEDYYHNVYLKRLNRYGIDFQSRMQRQREENFKLQLKKSVYYVEFEYKDEIHAGELTPLRQNETKTMQYLLTDIHLDMPNGTILFIPDKDMELRPWMIYYLEDIKASGYNRYIVIKMTHYLIWKDREGREQGTWAYFYGQEDNMLKDELKSRSRNKTLYTENLKLSFFIMPRNEFLRKDDYMEVGDGPLKEAYVVTGYDIQSTPGVEFVSVDPQYVRDQTPPPEQQEEDNKDDFFWINKGVENDG
Ga0256870_10053596F041054AGGGGGMAEYKVRNCLDLGINAQKIIKRLFANQNLMKLLYYTDKDPLSHEDLTKEQIEKEVFEKLVKIVPRVGPKETAHSIIALRIARGRQDMNNSEFKHITISLEIFVPLTQWIIKDTNLRPFAIMGEIQKSLDGKKIDGLGKMSGGDFDLDFLTEEISAYLMTFTLTSYD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.