Scaffold Ga0256406_1046722

Overview

Basic Information

• Taxon OID: 3300026522
• Scaffold ID: Ga0256406_1046722
• Source Dataset Name: Bovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_03
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1732
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: Alberta
• Coordinates
  • Lat. (^o): 49.6935
  • Long. (^o): -112.8418

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092835	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256406_10467222	F092835	N/A	PFWGQPRVRLRVGHQHSQFLSILVYFVHYYLRFWGPRAISMIDEPRGAFTCPSSTLTVLANSDPFRGLLLTVLGSRNNFHSC