Scaffold Ga0257168_1095454

Overview

Basic Information

• Taxon OID: 3300026514
• Scaffold ID: Ga0257168_1095454
• Source Dataset Name: Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 661
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 44.23
  • Long. (^o): -122.22

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018629	Metagenome / Metatranscriptome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257168_10954542	F018629	GAGG	MGTDKKTQIIIIKQGMAGSIPESKAVSEERQKKDAMADLVCSVSRWVAEFKRRRRPDPRITFQTQFKEA