| Basic Information | |
|---|---|
| Taxon OID | 3300026503 Open in IMG/M |
| Scaffold ID | Ga0247605_1009245 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2332 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 36.8313 | Long. (o) | -121.9047 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049671 | Metagenome / Metatranscriptome | 146 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247605_10092455 | F049671 | AGGAG | MVKVVIGTIGILGLASCNYAVADSPCDYVKDVQTNWTQQIEKTSNIDKKVFPYVEDTRKCMMTMDVTINGQTYPAEGSYVFGPDMSENDACDNATVNAKKSVISEVSPEILSAKTEMNCSIQENPVVAEAPTETVTIQEGTPVETETVISRKIVDRSTNNVVQYIPDRKTINIGGFTIGFNGYKEPGKCYANWQTGGTDCY |
| ⦗Top⦘ |