NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257156_1055893

Scaffold Ga0257156_1055893


Overview

Basic Information
Taxon OID3300026498 Open in IMG/M
Scaffold IDGa0257156_1055893 Open in IMG/M
Source Dataset NameSoil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)814
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)44.23Long. (o)-122.22Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071287Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0257156_10558932F071287N/ARRQPVRIVEGRKEGGYGAAFEVVCCDCGDHPYWGYSEISPSLQRIRGPYATMAAALAAHDRHLGLTTSRRRS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.