Scaffold Ga0247568_1003928

Overview

Basic Information

• Taxon OID: 3300026462
• Scaffold ID: Ga0247568_1003928
• Source Dataset Name: Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2436
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.8313
  • Long. (^o): -121.9047
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063074	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247568_10039282	F063074	N/A	MACTVNLTDIDYSCDDLGIGGIVELHVASKAAALTAITTKDDATRVISAAGAASDVVQIEFHLKDGFSVFSEVKTVDPTGGFTTVPTISVELPKMDASKITALDQMSNGPKEMVAFVKTAAGTLHVVGLDHGLYVSTVDGNSGTSRTEKNRFQLTLTGEEDGLSYSIDSTSFAAITA