Scaffold Ga0247607_1010870

Overview

Basic Information

• Taxon OID: 3300026447
• Scaffold ID: Ga0247607_1010870
• Source Dataset Name: Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1442
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.8313
  • Long. (^o): -121.9047
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023616	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247607_10108703	F023616	N/A	MRTGIINSADESPNQLILKALPLVLVKYREIVVDAVXDIIPCPENLIKKIAINNKKTEVILEKKKQANDKRIITKNANLKIFTSSIFFPTQINRRLLHKVADA