Scaffold Ga0256361_1014255

Overview

Basic Information

• Taxon OID: 3300026439
• Scaffold ID: Ga0256361_1014255
• Source Dataset Name: Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1359
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location

• Location Name: USA: Louisiana
• Coordinates
  • Lat. (^o): 29.8571
  • Long. (^o): -89.9778
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023494	Metagenome / Metatranscriptome	210	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256361_10142552	F023494	AGGTGG	MKGNTALNRAFISFPQLNRLVTTTNFIDKKAHVRELLFVTSFQLNQLSKLKTKELG