| Basic Information | |
|---|---|
| Taxon OID | 3300026399 Open in IMG/M |
| Scaffold ID | Ga0232082_122755 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S4 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 748 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 42.4447 | Long. (o) | -76.485 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043478 | Metagenome / Metatranscriptome | 156 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0232082_1227551 | F043478 | N/A | VSAMDPYDGHSAWKFQYSHPVKAEAKGRRISLLSWLANLVFLSGTLLFAYQFYGWFEHNEWTRYPSIALVKYLPAGCVGFLNEVSAVKASMLWLLDRADLSVILILMGFLIAKFLVDSK |
| ⦗Top⦘ |