Scaffold Ga0257179_1017554

Overview

Basic Information

• Taxon OID: 3300026371
• Scaffold ID: Ga0257179_1017554
• Source Dataset Name: Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 807
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 44.23
  • Long. (^o): -122.22

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054651	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257179_10175541	F054651	N/A	VTRLAPFIVAPLIIAIVILAGCASDTGIVLRGGQTEAQLAGDRTQCLPFVQAHTETSPELAEAACLVNRGYRAPLPLAQGPAGIGSLYATATRDASVIVADFQGCRVEAFNTPMPENREKKAPSGIFSSFFGQMFPRGFFTKAQTPDQWALQTFAACLNRRGYTVSDV