NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256810_1009018

Scaffold Ga0256810_1009018


Overview

Basic Information
Taxon OID3300026357 Open in IMG/M
Scaffold IDGa0256810_1009018 Open in IMG/M
Source Dataset NameSediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1103
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.3377Long. (o)-81.4644Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001490Metagenome / Metatranscriptome685Y

Sequences

Protein IDFamilyRBSSequence
Ga0256810_10090182F001490N/ATQLLQQIAQIQHMEPGKLCVLRQGPNRPYYNLQWREQGKALSRYVPADQVEVLAQHTANYQTFQSLVDQYAQLIIERTRAERAAGFKKKTWAPKSSWPKSRKSNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.