| Basic Information | |
|---|---|
| Taxon OID | 3300026349 Open in IMG/M |
| Scaffold ID | Ga0256811_1014151 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 763 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 31.3377 | Long. (o) | -81.4644 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000926 | Metagenome / Metatranscriptome | 832 | Y |
| F002347 | Metagenome / Metatranscriptome | 568 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256811_10141511 | F000926 | GGAG | VRTAVFKSANQLVGWLLQQAVDRFDKAYQPKPGQIRKGQDTLHVQGIFGSFPLSRDYYYHPLKGQGHYPADEALGLEISYTPALAKLLCLEGADEQTYLKAER |
| Ga0256811_10141512 | F002347 | N/A | MNSPTKQQVLQQISAIAFMERGKLSAYSFKDRPGHTGPYHKLQQWEDGKNRTRYVSADELGDVEAALAGYAQYQELTRQYADLVIAETRQNIASKKKSSRPKSGSPRKMKSSN |
| ⦗Top⦘ |