Scaffold Ga0257162_1001689

Overview

Basic Information

• Taxon OID: 3300026340
• Scaffold ID: Ga0257162_1001689
• Source Dataset Name: Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2429
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Levybacteria → Candidatus Levybacteria bacterium RIFCSPLOWO2_01_FULL_38_21 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 44.23
  • Long. (^o): -122.22

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050416	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257162_10016892	F050416	N/A	DLIEMIGEVDQKSKQWATQILYFSSHWFKELERQLADPECRGPAMELASYFNNTGWASLARVRYNDDQLTDALTELGGDSNAARCKAAYLLLRHSLQVLSQRRPCFALANDHADLGPLDTFRQELLQVARLDPTILVPGYLQAGQAGFLSLSQLVPSAFEESPEDSLEDVFKIILRARNAAMKQRVAVPGLDNLPELFSRLAFRVKSGRLRQKGRHGSILTFKINCSSHDSGGFQRESIPIEQFYAPFFSGDDLPTSDSRFFRVAVKLDLRE