NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209267_1004761

Scaffold Ga0209267_1004761


Overview

Basic Information
Taxon OID3300026331 Open in IMG/M
Scaffold IDGa0209267_1004761 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8192
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000517Metagenome / Metatranscriptome1061Y
F104063Metagenome101N

Sequences

Protein IDFamilyRBSSequence
Ga0209267_100476117F104063GGAGMSRVVVAAGIVGLLLFVEPPLDGLAGYLLFEEGHRIIRTIVVSVNAVTAAGVLFSFLPEWFHPRGLMLAAAIAHYNVNVWLGLVALVYAVAVGAWPPALVLLVGAVLVAIGGRGVVAWLSSGRSRL
Ga0209267_10047613F000517AGGAGMRMHLALLLAAVFALSPFDGIAGEKQIVDVKELAGRWQGWVTREQGQERATLIVSADGSYRALTPQGASTEGKFYLQDGKLRYRSSRTTGTASLSEDRGKTMLTVMPEDPKYHTGRAEYERVKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.