NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209055_1019583

Scaffold Ga0209055_1019583


Overview

Basic Information
Taxon OID3300026309 Open in IMG/M
Scaffold IDGa0209055_1019583 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3279
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006774Metagenome / Metatranscriptome365Y
F009201Metagenome321Y

Sequences

Protein IDFamilyRBSSequence
Ga0209055_10195833F009201AGGAGGVPMVSLSFLNRRTIKQVCRICHELDELKTDRLCARCVWIKSQIRLRFPDAVRGTTGIPAEQSCRRSGCLCAACGVRTLDAHPLHPSNPTRADRRELHLHPRCHELWLEIGLGARPEQDIDIGQA
Ga0209055_10195836F006774AGGAGGVLSSRSPTTGALGVTQAGVVPPGVRPSGPLCIGDAPMAEQQTATCPECSRTISPGDTIVFGHGRLGHLVCRRPRVLSAEERTLLLIYCRDHPVAECVRCAGKFHLREVASIDQFGIRSHGCPWCHTDLTDSIRAHLYGCAMLPVAVRRRAQVAREAARNLVKQSHQLRDAADVAVREAEGALHALRLAMRQSPNRRVA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.