Scaffold Ga0209234_1012650

Overview

Basic Information

• Taxon OID: 3300026295
• Scaffold ID: Ga0209234_1012650
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3204
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: Angelo Coastal Reserve, California, USA
• Coordinates
  • Lat. (^o): 39.718176
  • Long. (^o): -123.652732

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005396	Metagenome	402	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209234_10126503	F005396	N/A	VALVRFLAVLFSLLSAVGLSGCSDDQSQPPPLQATASSSVGCKAGQSYQHTTLGYHLCFPGGWTSRDYTAEPGSGGAVSVVAFGPPAAVPAHVPSSGTFSPPIEVRVIAGPKDQAEASLTEGNQVTQTKVAGIAADRIVVMDSGPANGAVFVVFERQGNTFEVEEAPGGTFDAAFQQVLVSFTFPG