NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209227_1007621

Scaffold Ga0209227_1007621


Overview

Basic Information
Taxon OID3300026293 Open in IMG/M
Scaffold IDGa0209227_1007621 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5904
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002970Metagenome / Metatranscriptome517N
F004791Metagenome / Metatranscriptome423Y
F005302Metagenome / Metatranscriptome405Y
F039435Metagenome / Metatranscriptome163N

Sequences

Protein IDFamilyRBSSequence
Ga0209227_10076212F002970GGAGMSYSAVTDIIEMLAGLTVQYNSVVVPVQRLAAQANWSDAAQLPVRIIPTIGGLRLIEGGVYTPTRATRAVWEIDDLLLVRDVGMGRGVADTASALVNYIEDYVARLRSAWLARGDVQLLNVSGIIDVVRYGERAYEGATVTTRFAHLIRAPST
Ga0209227_10076213F005302AGGAGGMPHSGVIAGLYAGNFAVEISTDGTTWTAVSDATVKIDDVEMNRPSGEAYVGGSSDYATITIGKREPVEITLTFLYSEATNAAATTIYDQFESATPTLGVRWSPRGLVANARAYATSNDGSATGLGVITNVTLSALDPGEAEPYVALVTVRTPTLRQYTLGAAPTDLS
Ga0209227_10076214F004791AGGAGGMSEPATIYDVDAIRVDRTALTIREAATLLNRELTPEVIARLVRKAIGNQADQFPIRALKAVYERALPKIFEPDEAIRSRVAGLMPNVTTITLGEYHQFLEASERKIAFPDVAATLLAKAYGDDILNEPYAAAALLLKRIFDAVGDEGNG
Ga0209227_10076217F039435AGGAGGMLVAITRPHQRFPVPLSAADYEFTTSDDGDERGRVTLPPALARSGVMTQIGDELAVYCTQLSKTIWRGQIERIEEARDGSITWHALGFG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.