| Basic Information | |
|---|---|
| Taxon OID | 3300026290 Open in IMG/M |
| Scaffold ID | Ga0209510_1152816 Open in IMG/M |
| Source Dataset Name | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 765 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin145 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Washington, USA | |||||||
| Coordinates | Lat. (o) | 47.6525 | Long. (o) | -122.3049 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047561 | Metagenome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209510_11528162 | F047561 | GGAGG | MTVSNIEPQNIVPDFGTLKRGKLDILVNWDIASATKTDDMGNEYTEWQYESIRLNWVLPAVYESEAAIQAYLNANYDAGENILGWAQATRVSKSSVGT |
| ⦗Top⦘ |