NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208411_1006760

Scaffold Ga0208411_1006760


Overview

Basic Information
Taxon OID3300026279 Open in IMG/M
Scaffold IDGa0208411_1006760 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5513
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (81.25%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007121Metagenome / Metatranscriptome357Y
F035477Metagenome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0208411_100676014F035477GAGGMMKIPQKFLQNFKYFTEAKMARQHFQLIADIISKLDISTVIKKEVASAFADGLEDTNPIFKRDAFMKATKTKNKGIPTVKDK
Ga0208411_10067607F007121N/AVFKTILLAIFLLFGVTTPATGNWQIVLQDKLQEPTLDKLIDWVPEEVPRTVSFYFDTDGDGKFDLKIAYSLIEAYPCNAYNCVNMIIDNGDHWILPAPGMNYFVIKKWTLYRYVDDEDWRGVYRTQQWIFKYPYYDDWLKEKFYPLWPEQMQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.