NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209350_1000867

Scaffold Ga0209350_1000867


Overview

Basic Information
Taxon OID3300026277 Open in IMG/M
Scaffold IDGa0209350_1000867 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14594
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.73825Long. (o)-123.6301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002984Metagenome / Metatranscriptome515Y
F005977Metagenome / Metatranscriptome384N
F068550Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0209350_10008674F068550GAGMLAAQRVGGGRLIACTPLAYDSVTQVIGPAGGFLVAGGHVLVVDSLALSSPVSITAVAPSQSVNLVRFRPEGLKFKPGVHGIGALVATNLDNCNVHPNQVLQVVNVTDSLSILTYLQAPTTADSAVVVKYKTYLGSLWVGGLLHHFSNYAVAW
Ga0209350_10008675F002984AGGAMDSETRVSVRRSLIPLALAACATAAAVSCGGPSPVGVDLQAPALPEAARQTLPATKGSGLVACSQTYDSVTQVIGPAGGLIVVGHHFLWVDSMALSDTVRITAVAPADTVRWVRFHPDGLQFRTNGAGWSALLYTSFKDCGVPTVDTLQIAQVTDSLNIIRYLAPADSTWIRVRKKGWSKGNQYVAGVLHHFSQYAVSW
Ga0209350_10008679F005977GGALTYRQFAAELGKPVTAAAVKKWPQRKHVPADAARLIVTRARDRGIGGVTLEWVLFGEGSGPERERLPGLEAAHLAPPSAGQEPHGRVPAAIATALQADLNHNEFGQWSSIEVQRTVLWALKDLARRLRTLRFDMGKTFELTDEWAGNIGLPVRPQERSSDAPGEGPARRVGRHTADE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.