Scaffold Ga0209847_1095680

Overview

Basic Information

• Taxon OID: 3300026276
• Scaffold ID: Ga0209847_1095680
• Source Dataset Name: Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 551
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location

• Location Name: Arctic
• Coordinates
  • Lat. (^o): 68.6137
  • Long. (^o): -149.3144
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005918	Metagenome / Metatranscriptome	386	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209847_10956801	F005918	N/A	MSSDRNRLQALVDALPDTEVQVAISFLAELGEQEFIDAETAAKLDLARAKPGDDVPLEEVRRRLGL