NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208522_1004816

Scaffold Ga0208522_1004816


Overview

Basic Information
Taxon OID3300026254 Open in IMG/M
Scaffold IDGa0208522_1004816 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7316
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010943Metagenome297Y
F016675Metagenome / Metatranscriptome245Y

Sequences

Protein IDFamilyRBSSequence
Ga0208522_100481611F016675N/AMRKFEVDYETTLPPWHTGHEKVEAEDLNSVKEKFDRKHEAARIYKITEVIYDQRLVAS
Ga0208522_10048163F010943N/AMTSEELHTYLMELKNKNVQSPDIVTYKETIREALDQYRTTIPRTNLMLNERQGVNKNVVFYSFMEAPNKPAIGDHELKRMRISWRSLRKFNKDIEVRFCYDGEDVRWTELCDEFDIKMYGFSDTFKGTEPNAWCIHRWYNMSQWADEDLNLLYMDADTYCHGDIGLLFDIYKRDPVYGREELGFRHDPNLGCAGEDPRFYLDLLDAAIMSQGGKTEVQKYCLGVILLNQSVHKLFTPEVMEYYTDLLERIRTFKVFYSIPNYRIMDEFAFWILMSRWSIRTSLFGDQDVSQTFLEKKHENHFNPIVLHYTTYAEEKFADWAPEFYCLSRSLEEREFADVAAGGIYNVTPLMREELAMSMW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.