Scaffold Ga0209947_1062051

Overview

Basic Information

• Taxon OID: 3300026251
• Scaffold ID: Ga0209947_1062051
• Source Dataset Name: Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D2_MG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1511
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4961
  • Long. (^o): -122.1331
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022114	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209947_10620513	F022114	N/A	MTMNRGSMAKQVTEAPMKKRKGYMKGGSVKTGYKNGGTVKGYRKGGSVDQTQCSPRKRMAMGERDG