NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209313_1016975

Scaffold Ga0209313_1016975


Overview

Basic Information
Taxon OID3300026198 Open in IMG/M
Scaffold IDGa0209313_1016975 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2238
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029451Metagenome / Metatranscriptome188N
F054066Metagenome / Metatranscriptome140N
F101228Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0209313_10169752F101228GAGGMEEIYGNTDRLRDVWNWVAERWAYFTVIGLAYLIIYYASGSAMQAVYGILLCICMWLGILWVNRLPHEDRVFWKRLVGITIILLAVAVAITYNPVSALTITGDPAGDQIHWEITDGEPPYTVFINGIEIVSGYPGTVISTDAAPGRQYTAVVMDNQSVADATVTGEYYTYPLWVWLLFAALVVCLIVSIWLPYAAFGAAIAGGFLLLMVAPNPDYAAYLRIFAGAAFIVGLAGLAGRLHS
Ga0209313_10169754F054066AGGMFGTTRKPKELNRFRVGKGSPGLKAVLYRMTNKSYLDIRIYRGYREVTRIVTPDTGMRRFVVDGVGAFVMPNEEQMLRQLHDRHALYIPYNINSSAPGEVTDDLEPVAFVYPPLSPAEFQAELEAQTVADLLAETEKDMSWIWLLAGGAVLIFVLILLFGGA
Ga0209313_10169755F029451GGAGGLVVDFEDLIASTSSSAGKPSIIEALLSTVDAIFTNNRMLQRSRLSSRNIRGVVRVIGSQAFLRARLERSYKPFLDPDTGEFTYNRYDNRVLTAVCEGALSGRISLDGKSRDEIIRIFQAVGNTGQEQPVGRGGGILGRFDY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.